Lineage for d3obqa_ (3obq A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2183821Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2183822Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2184177Family d.20.1.2: UEV domain [75383] (3 proteins)
  6. 2184178Protein Tumor susceptibility gene 101 (TSG101) [75384] (1 species)
  7. 2184179Species Human (Homo sapiens) [TaxId:9606] [75385] (13 PDB entries)
  8. 2184182Domain d3obqa_: 3obq A: [182921]
    automated match to d1kppa_

Details for d3obqa_

PDB Entry: 3obq (more details), 1.4 Å

PDB Description: crystal structure of the tsg101 uev domain in complex with a human hrs psap peptide
PDB Compounds: (A:) Tumor susceptibility gene 101 protein

SCOPe Domain Sequences for d3obqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3obqa_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]}
avsesqlkkmvskykyrdltvretvnvitlykdlkpvldsygtgsrelmnltgtipvpyr
gntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpqsdl
lgliqvmivvfgdeppvfsrp

SCOPe Domain Coordinates for d3obqa_:

Click to download the PDB-style file with coordinates for d3obqa_.
(The format of our PDB-style files is described here.)

Timeline for d3obqa_: