SCOPe 2.05: Domain d1nbmf1: 1nbm F:358-474

Lineage for d1nbmf1 (1nbm F:358-474)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (2 families)

5. Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)

6. Protein F1 ATP synthase beta subunit, domain 3 [88928] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [88929] (18 PDB entries)
   Uniprot P00829

8. Domain d1nbmf1: 1nbm F:358-474 [18292]
   Other proteins in same PDB: d1nbma1, d1nbma2, d1nbma3, d1nbmb1, d1nbmb2, d1nbmb3, d1nbmc1, d1nbmc2, d1nbmc3, d1nbmd2, d1nbmd3, d1nbme2, d1nbme3, d1nbmf2, d1nbmf3, d1nbmg_
   complexed with adp, atp, mg, po4

Details for d1nbmf1

PDB Entry: 1nbm, 3 Å

PDB Description: the structure of bovine f1-atpase covalently inhibited with 4-chloro-7-nitrobenzofurazan

PDB Compounds: (F:) f1-ATPase

SCOPe Domain Sequences for d1nbmf1:

Sequence; same for both SEQRES and ATOM records:

>d1nbmf1 a.69.1.1 (F:358-474) F1 ATP synthase beta subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadkla

Timeline for d1nbmf1:

• d1nbmf1 first appeared (with stable ids) in SCOP 1.55
  
• d1nbmf1 appears in SCOPe 2.04
  
• d1nbmf1 appears in SCOPe 2.06
  
• d1nbmf1 appears in the current release, SCOPe 2.08