Lineage for d1nbmf1 (1nbm F:358-474)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 282945Fold a.69: Left-handed superhelix [47916] (3 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 282946Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 282947Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 282987Protein F1 ATP synthase beta subunit, domain 3 [88928] (4 species)
  7. 282990Species Cow (Bos taurus) [TaxId:9913] [88929] (10 PDB entries)
  8. 283008Domain d1nbmf1: 1nbm F:358-474 [18292]
    Other proteins in same PDB: d1nbma1, d1nbma2, d1nbma3, d1nbmb1, d1nbmb2, d1nbmb3, d1nbmc1, d1nbmc2, d1nbmc3, d1nbmd2, d1nbmd3, d1nbme2, d1nbme3, d1nbmf2, d1nbmf3, d1nbmg_
    complexed with adp, atp, mg, po4, tyn

Details for d1nbmf1

PDB Entry: 1nbm (more details), 3 Å

PDB Description: the structure of bovine f1-atpase covalently inhibited with 4-chloro-7-nitrobenzofurazan

SCOP Domain Sequences for d1nbmf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nbmf1 a.69.1.1 (F:358-474) F1 ATP synthase beta subunit, domain 3 {Cow (Bos taurus)}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadkla

SCOP Domain Coordinates for d1nbmf1:

Click to download the PDB-style file with coordinates for d1nbmf1.
(The format of our PDB-style files is described here.)

Timeline for d1nbmf1: