Lineage for d3ob9e_ (3ob9 E:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309919Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1311416Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 1311567Family b.34.13.0: automated matches [191621] (1 protein)
    not a true family
  6. 1311568Protein automated matches [191139] (2 species)
    not a true protein
  7. 1311572Species Human (Homo sapiens) [TaxId:9606] [189257] (6 PDB entries)
  8. 1311591Domain d3ob9e_: 3ob9 E: [182913]
    automated match to d2efia1
    complexed with nhe, so4

Details for d3ob9e_

PDB Entry: 3ob9 (more details), 2.5 Å

PDB Description: Structure of the human MSL3 chromo-barrel domain at 2.5 Angstrom resolution
PDB Compounds: (E:) Male-specific lethal 3-like 1 (Drosophila), isoform CRA_c

SCOPe Domain Sequences for d3ob9e_:

Sequence, based on SEQRES records: (download)

>d3ob9e_ b.34.13.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kfkfhsgekvlcfepdptkarvlydakivdvivgkdekgrkipeylihfngwnrswdrwa
aedhvlrdtdenrrlqrklarkava

Sequence, based on observed residues (ATOM records): (download)

>d3ob9e_ b.34.13.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kfkfhsgekvlcfepdptkarvlydakivdvivgkipeylihfngwnrswdrwaaedhvl
rdtdenrrlqrklarkava

SCOPe Domain Coordinates for d3ob9e_:

Click to download the PDB-style file with coordinates for d3ob9e_.
(The format of our PDB-style files is described here.)

Timeline for d3ob9e_: