SCOPe 2.08: Domain d1nbme1: 1nbm E:358-474

Lineage for d1nbme1 (1nbm E:358-474)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families)

5. Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)

6. Protein F1 ATP synthase beta subunit, domain 3 [88928] (5 species)

7. Species Cow (Bos taurus) [TaxId:9913] [88929] (18 PDB entries)
   Uniprot P00829

8. Domain d1nbme1: 1nbm E:358-474 [18291]
   Other proteins in same PDB: d1nbma1, d1nbma2, d1nbma3, d1nbmb1, d1nbmb2, d1nbmb3, d1nbmc1, d1nbmc2, d1nbmc3, d1nbmd2, d1nbmd3, d1nbme2, d1nbme3, d1nbmf2, d1nbmf3, d1nbmg_
   complexed with adp, atp, mg, po4

Details for d1nbme1

PDB Entry: 1nbm, 3 Å

PDB Description: the structure of bovine f1-atpase covalently inhibited with 4-chloro-7-nitrobenzofurazan

PDB Compounds: (E:) f1-ATPase

SCOPe Domain Sequences for d1nbme1:

Sequence; same for both SEQRES and ATOM records:

>d1nbme1 a.69.1.1 (E:358-474) F1 ATP synthase beta subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadkla

Timeline for d1nbme1:

• d1nbme1 first appeared (with stable ids) in SCOP 1.55
  
• d1nbme1 appears in SCOPe 2.07