Lineage for d3oamc_ (3oam C:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1001844Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 1001845Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 1002257Family c.68.1.13: Cytidylytransferase [68901] (7 proteins)
  6. 1002338Protein automated matches [190992] (5 species)
    not a true protein
  7. 1002354Species Vibrio cholerae [TaxId:243277] [189477] (1 PDB entry)
  8. 1002357Domain d3oamc_: 3oam C: [182904]
    automated match to d1vica_
    complexed with na

Details for d3oamc_

PDB Entry: 3oam (more details), 1.75 Å

PDB Description: Crystal structure of cytidylyltransferase from Vibrio cholerae
PDB Compounds: (C:) 3-deoxy-manno-octulosonate cytidylyltransferase

SCOPe Domain Sequences for d3oamc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oamc_ c.68.1.13 (C:) automated matches {Vibrio cholerae [TaxId: 243277]}
msftvviparyqstrlpgkpladiggkpmiqwvyeqamqagadrviiatdderveqavqa
fggvvcmtspnhqsgterlaevvakmaipadhivvnvqgdeplippaiirqvadnlaacs
apmatlaveiedeaevfnpnavkvitdksgyalyfsratipwdrdnfakadkaivqpllr
higiyayragfintyldwqpsqlekiecleqlrvlwhgekihvavaleappagvdtpedl
evvrrivaera

SCOPe Domain Coordinates for d3oamc_:

Click to download the PDB-style file with coordinates for d3oamc_.
(The format of our PDB-style files is described here.)

Timeline for d3oamc_: