Lineage for d3oamc_ (3oam C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2898986Family c.68.1.13: Cytidylytransferase [68901] (7 proteins)
  6. 2899085Protein automated matches [190992] (6 species)
    not a true protein
  7. 2899103Species Vibrio cholerae [TaxId:243277] [189477] (1 PDB entry)
  8. 2899106Domain d3oamc_: 3oam C: [182904]
    automated match to d1vica_
    complexed with na

Details for d3oamc_

PDB Entry: 3oam (more details), 1.75 Å

PDB Description: Crystal structure of cytidylyltransferase from Vibrio cholerae
PDB Compounds: (C:) 3-deoxy-manno-octulosonate cytidylyltransferase

SCOPe Domain Sequences for d3oamc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oamc_ c.68.1.13 (C:) automated matches {Vibrio cholerae [TaxId: 243277]}
msftvviparyqstrlpgkpladiggkpmiqwvyeqamqagadrviiatdderveqavqa
fggvvcmtspnhqsgterlaevvakmaipadhivvnvqgdeplippaiirqvadnlaacs
apmatlaveiedeaevfnpnavkvitdksgyalyfsratipwdrdnfakadkaivqpllr
higiyayragfintyldwqpsqlekiecleqlrvlwhgekihvavaleappagvdtpedl
evvrrivaera

SCOPe Domain Coordinates for d3oamc_:

Click to download the PDB-style file with coordinates for d3oamc_.
(The format of our PDB-style files is described here.)

Timeline for d3oamc_: