Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) |
Family c.68.1.13: Cytidylytransferase [68901] (7 proteins) |
Protein automated matches [190992] (5 species) not a true protein |
Species Vibrio cholerae [TaxId:243277] [189477] (1 PDB entry) |
Domain d3oama_: 3oam A: [182902] automated match to d1vica_ complexed with na |
PDB Entry: 3oam (more details), 1.75 Å
SCOPe Domain Sequences for d3oama_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oama_ c.68.1.13 (A:) automated matches {Vibrio cholerae [TaxId: 243277]} msftvviparyqstrlpgkpladiggkpmiqwvyeqamqagadrviiatdderveqavqa fggvvcmtspnhqsgterlaevvakmaipadhivvnvqgdeplippaiirqvadnlaacs apmatlaveiedeaevfnpnavkvitdksgyalyfsratipwdrdnfakadkaivqpllr higiyayragfintyldwqpsqlekiecleqlrvlwhgekihvavaleappagvdtpedl evvrrivaeraq
Timeline for d3oama_: