SCOPe 2.05: Domain d3o9pa_: 3o9p A:

Lineage for d3o9pa_ (3o9p A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (120 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [189696] (1 PDB entry)

8. Domain d3o9pa_: 3o9p A: [182899]
   automated match to d1b05a_
   complexed with mhi, zn

Details for d3o9pa_

PDB Entry: 3o9p, 2.07 Å

PDB Description: The structure of the Escherichia coli murein tripeptide binding protein MppA

PDB Compounds: (A:) Periplasmic murein peptide-binding protein

SCOPe Domain Sequences for d3o9pa_:

Sequence; same for both SEQRES and ATOM records:

>d3o9pa_ c.94.1.0 (A:) automated matches {Escherichia coli [TaxId: 562]}
tvlaekqelvrhikdepasldpakavglpeiqvirdlfeglvnqnekgeivpgvatqwks
ndnriwtftlrdnakwadgtpvtaqdfvyswqrlvdpktlspfawfaalaginnaqaiid
gkatpdqlgvtavdahtlkiqldkplpwfvnltanfaffpvqkanvesgkewtkpgnlig
ngayvlkervvneklvvvpnthywdnaktvlqkvtflpinqesaatkrylagdiditesf
pknmyqkllkdipgqvytppqlgtyyyafntqkgptadqrvrlalsmtidrrlmtekvlg
tgekpawhftpdvtagftpepspfeqmsqeelnaqaktllsaagygpqkplkltllynts
enhqkiaiavasmwkknlgvdvklqnqewktyidsrntgnfdviraswvgdynepstflt
lltsthsgnisrfnnpaydkvlaqastentvkarnadynaaekilmeqapiapiyqytng
rlikpwlkgypinnpedvaysrtmyivkh

Timeline for d3o9pa_:

• d3o9pa_ first appeared in SCOPe 2.01
  
• d3o9pa_ appears in SCOPe 2.04
  
• d3o9pa_ appears in SCOPe 2.06
  
• d3o9pa_ appears in the current release, SCOPe 2.08