Lineage for d3o9ja_ (3o9j A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1326286Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 1326287Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 1326637Family b.68.1.0: automated matches [191452] (1 protein)
    not a true family
  6. 1326638Protein automated matches [190692] (7 species)
    not a true protein
  7. 1326647Species Influenza a virus (a/duck/ukraine/1/1963(h3n8)) [TaxId:385580] [189572] (2 PDB entries)
  8. 1326648Domain d3o9ja_: 3o9j A: [182896]
    automated match to d2bata_
    complexed with ca, ndg, rp6

Details for d3o9ja_

PDB Entry: 3o9j (more details), 2 Å

PDB Description: influenza na in complex with compound 5
PDB Compounds: (A:) Neuraminidase

SCOPe Domain Sequences for d3o9ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o9ja_ b.68.1.0 (A:) automated matches {Influenza a virus (a/duck/ukraine/1/1963(h3n8)) [TaxId: 385580]}
tymnnteaicdakgfapfskdngirigsrghifvirepfvscspiecrtffltqgsllnd
khsngtvkdrspfrtlmsvevgqspnvyqarfeavawsatachdgkkwmtvgvtgpdska
vavihyggvptdvvnswagdilrtqessctciqgdcywvmtdgpanrqaqyriykanqgr
iigqtdisfngghieecscypndgkvecvcrdnwtgtnrpvlvispdlsyrvgylcagip
sdtprgedtqftgsctspmgnqgygvkgfgfrqgtdvwmgrtisrtsrsgfeilrikngw
tqtskeqirkqvvvdnlnwsgysgsftlpvelsgkdclvpcfwvemirgkpeektiwtss
ssivmcgvdyevadwswhdgailpfdi

SCOPe Domain Coordinates for d3o9ja_:

Click to download the PDB-style file with coordinates for d3o9ja_.
(The format of our PDB-style files is described here.)

Timeline for d3o9ja_: