Lineage for d1nbmc1 (1nbm C:380-510)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 643803Fold a.69: Left-handed superhelix [47916] (3 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 643804Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 643805Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 643806Protein F1 ATP synthase alpha subunit, domain 3 [88886] (4 species)
  7. 643809Species Cow (Bos taurus) [TaxId:9913] [88893] (12 PDB entries)
  8. 643833Domain d1nbmc1: 1nbm C:380-510 [18289]
    Other proteins in same PDB: d1nbma2, d1nbma3, d1nbmb2, d1nbmb3, d1nbmc2, d1nbmc3, d1nbmd1, d1nbmd2, d1nbmd3, d1nbme1, d1nbme2, d1nbme3, d1nbmf1, d1nbmf2, d1nbmf3, d1nbmg_
    complexed with adp, atp, mg, po4, tyn

Details for d1nbmc1

PDB Entry: 1nbm (more details), 3 Å

PDB Description: the structure of bovine f1-atpase covalently inhibited with 4-chloro-7-nitrobenzofurazan
PDB Compounds: (C:) f1-ATPase

SCOP Domain Sequences for d1nbmc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nbmc1 a.69.1.1 (C:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke
ivtnflagfea

SCOP Domain Coordinates for d1nbmc1:

Click to download the PDB-style file with coordinates for d1nbmc1.
(The format of our PDB-style files is described here.)

Timeline for d1nbmc1: