SCOPe 2.01: Domain d3o9ab_: 3o9a B:

Lineage for d3o9ab_ (3o9a B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein automated matches [190433] (10 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [187327] (21 PDB entries)

8. Domain d3o9ab_: 3o9a B: [182883]
   automated match to d1kzka_
   complexed with k14, po4

Details for d3o9ab_

PDB Entry: 3o9a, 1.9 Å

PDB Description: crystal structure of wild-type hiv-1 protease in complex with kd14

PDB Compounds: (B:) Pol polyprotein

SCOPe Domain Sequences for d3o9ab_:

Sequence; same for both SEQRES and ATOM records:

>d3o9ab_ b.50.1.1 (B:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipieicghkaigtvlvgptpvniigrnlltqigctlnf

Timeline for d3o9ab_:

• d3o9ab_ is new in SCOPe 2.01-stable
  
• d3o9ab_ appears in SCOPe 2.02
  
• d3o9ab_ appears in the current release, SCOPe 2.08