Lineage for d1nbma1 (1nbm A:380-510)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330430Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2330431Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families) (S)
  5. 2330432Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 2330433Protein F1 ATP synthase alpha subunit, domain 3 [88886] (5 species)
  7. 2330452Species Cow (Bos taurus) [TaxId:9913] [88893] (15 PDB entries)
    Uniprot P19483
  8. 2330480Domain d1nbma1: 1nbm A:380-510 [18287]
    Other proteins in same PDB: d1nbma2, d1nbma3, d1nbmb2, d1nbmb3, d1nbmc2, d1nbmc3, d1nbmd1, d1nbmd2, d1nbmd3, d1nbme1, d1nbme2, d1nbme3, d1nbmf1, d1nbmf2, d1nbmf3, d1nbmg_
    complexed with adp, atp, mg, po4

Details for d1nbma1

PDB Entry: 1nbm (more details), 3 Å

PDB Description: the structure of bovine f1-atpase covalently inhibited with 4-chloro-7-nitrobenzofurazan
PDB Compounds: (A:) f1-ATPase

SCOPe Domain Sequences for d1nbma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nbma1 a.69.1.1 (A:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke
ivtnflagfea

SCOPe Domain Coordinates for d1nbma1:

Click to download the PDB-style file with coordinates for d1nbma1.
(The format of our PDB-style files is described here.)

Timeline for d1nbma1: