Lineage for d1nbma1 (1nbm A:380-510)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4749Fold a.69: Left-handed superhelix [47916] (2 superfamilies)
  4. 4750Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 4751Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (1 protein)
  6. 4752Protein C-terminal domain of alpha and beta subunits of F1 ATP synthase [47919] (3 species)
  7. 4756Species Cow (Bos taurus) [TaxId:9913] [47920] (7 PDB entries)
  8. 4781Domain d1nbma1: 1nbm A:380-510 [18287]
    Other proteins in same PDB: d1nbma2, d1nbma3, d1nbmb2, d1nbmb3, d1nbmc2, d1nbmc3, d1nbmd2, d1nbmd3, d1nbme2, d1nbme3, d1nbmf2, d1nbmf3, d1nbmg_

Details for d1nbma1

PDB Entry: 1nbm (more details), 3 Å

PDB Description: the structure of bovine f1-atpase covalently inhibited with 4-chloro-7-nitrobenzofurazan

SCOP Domain Sequences for d1nbma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nbma1 a.69.1.1 (A:380-510) C-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke
ivtnflagfea

SCOP Domain Coordinates for d1nbma1:

Click to download the PDB-style file with coordinates for d1nbma1.
(The format of our PDB-style files is described here.)

Timeline for d1nbma1: