Lineage for d1bmff1 (1bmf F:358-474)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4749Fold a.69: Left-handed superhelix [47916] (2 superfamilies)
  4. 4750Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 4751Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (1 protein)
  6. 4752Protein C-terminal domain of alpha and beta subunits of F1 ATP synthase [47919] (3 species)
  7. 4756Species Cow (Bos taurus) [TaxId:9913] [47920] (7 PDB entries)
  8. 4774Domain d1bmff1: 1bmf F:358-474 [18286]
    Other proteins in same PDB: d1bmfa2, d1bmfa3, d1bmfb2, d1bmfb3, d1bmfc2, d1bmfc3, d1bmfd2, d1bmfd3, d1bmfe2, d1bmfe3, d1bmff2, d1bmff3, d1bmfg_

Details for d1bmff1

PDB Entry: 1bmf (more details), 2.85 Å

PDB Description: bovine mitochondrial f1-atpase

SCOP Domain Sequences for d1bmff1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bmff1 a.69.1.1 (F:358-474) C-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadkla

SCOP Domain Coordinates for d1bmff1:

Click to download the PDB-style file with coordinates for d1bmff1.
(The format of our PDB-style files is described here.)

Timeline for d1bmff1: