Lineage for d3o7mc_ (3o7m C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2128255Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2128256Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2128696Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2128697Protein automated matches [190891] (32 species)
    not a true protein
  7. 2128711Species Bacillus anthracis [TaxId:261594] [189450] (7 PDB entries)
  8. 2128715Domain d3o7mc_: 3o7m C: [182859]
    automated match to d1r3ub_
    complexed with bme, gol, so4

Details for d3o7mc_

PDB Entry: 3o7m (more details), 1.98 Å

PDB Description: 1.98 angstrom resolution crystal structure of a hypoxanthine-guanine phosphoribosyltransferase (hpt-2) from bacillus anthracis str. 'ames ancestor'
PDB Compounds: (C:) hypoxanthine phosphoribosyltransferase

SCOPe Domain Sequences for d3o7mc_:

Sequence, based on SEQRES records: (download)

>d3o7mc_ c.61.1.0 (C:) automated matches {Bacillus anthracis [TaxId: 261594]}
ieikdtliseeqlqekvkelalqierdfegeeivviavlkgsfvfaadlirhikndvtid
fisassygnqtettgkvkllkdidvnitgknvivvediidsgltlhflkdhffmhkpkal
kfctlldkperrkvdltaeyvgfqipdefivgygidcaekyrnlpfiasvv

Sequence, based on observed residues (ATOM records): (download)

>d3o7mc_ c.61.1.0 (C:) automated matches {Bacillus anthracis [TaxId: 261594]}
ieikdtliseeqlqekvkelalqierdfegeeivviavlkgsfvfaadlirhikndvtid
fisassygkvkllkdidvnitgknvivvediidsgltlhflkdhffmhkpkalkfctlld
kperrkvdltaeyvgfqipdefivgygidcaekyrnlpfiasvv

SCOPe Domain Coordinates for d3o7mc_:

Click to download the PDB-style file with coordinates for d3o7mc_.
(The format of our PDB-style files is described here.)

Timeline for d3o7mc_: