SCOPe 2.06: Domain d3o7ma_: 3o7m A:

Lineage for d3o7ma_ (3o7m A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (32 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:261594] [189450] (7 PDB entries)

8. Domain d3o7ma_: 3o7m A: [182857]
   automated match to d1r3ub_
   complexed with bme, gol, so4

Details for d3o7ma_

PDB Entry: 3o7m, 1.98 Å

PDB Description: 1.98 angstrom resolution crystal structure of a hypoxanthine-guanine phosphoribosyltransferase (hpt-2) from bacillus anthracis str. 'ames ancestor'

PDB Compounds: (A:) hypoxanthine phosphoribosyltransferase

SCOPe Domain Sequences for d3o7ma_:

Sequence, based on SEQRES records:

>d3o7ma_ c.61.1.0 (A:) automated matches {Bacillus anthracis [TaxId: 261594]}
nieikdtliseeqlqekvkelalqierdfegeeivviavlkgsfvfaadlirhikndvti
dfisassygnqtettgkvkllkdidvnitgknvivvediidsgltlhflkdhffmhkpka
lkfctlldkperrkvdltaeyvgfqipdefivgygidcaekyrnlpfiasvvt

Sequence, based on observed residues (ATOM records):

>d3o7ma_ c.61.1.0 (A:) automated matches {Bacillus anthracis [TaxId: 261594]}
nieikdtliseeqlqekvkelalqierdfegeeivviavlkgsfvfaadlirhikndvti
dfisassygkvkllkdidvnitgknvivvediidsgltlhflkdhffmhkpkalkfctll
dkperrkvdltaeyvgfqipdefivgygidcaekyrnlpfiasvvt

Timeline for d3o7ma_:

• d3o7ma_ first appeared in SCOPe 2.01
  
• d3o7ma_ appears in SCOPe 2.05
  
• d3o7ma_ appears in SCOPe 2.07
  
• d3o7ma_ appears in the current release, SCOPe 2.08