Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein automated matches [190091] (10 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187169] (27 PDB entries) |
Domain d3o7lb_: 3o7l B: [182855] automated match to d1cmke_ complexed with anp, mg, peg |
PDB Entry: 3o7l (more details), 2.8 Å
SCOPe Domain Sequences for d3o7lb_:
Sequence, based on SEQRES records: (download)
>d3o7lb_ d.144.1.7 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} eflakakedflkkwetpsqntaqldqfdriktlgtgsfgrvmlvkhkesgnhyamkildk qkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvaggemfshlrrig rfsepharfyaaqivltfeylhsldliyrdlkpenliidqqgyiqvtdfgfakrvkgrtw tlcgtpeylapeiiiskgynkavdwwalgvliyemaagyppffadqpiqiyekivsgkvr fpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkveapfip kfkgpgdtsnfddyeeeeirvsinekcgkeftef
>d3o7lb_ d.144.1.7 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} eflakakedflkkwetpsqntaqldqfdriktlgtgrvmlvkhkesgnhyamkildkqkv vklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvaggemfshlrrigrfs epharfyaaqivltfeylhsldliyrdlkpenliidqqgyiqvtdfgfakrvkgrtwtlc gtpeylapeiiiskgynkavdwwalgvliyemaagyppffadqpiqiyekivsgkvrfps hfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkveapfipkfk gpgdtsnfddyeeeeirvscgkeftef
Timeline for d3o7lb_: