SCOPe 2.06: Domain d3o6yx1: 3o6y X:2-245

Lineage for d3o6yx1 (3o6y X:2-245)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins)

6. Protein automated matches [190053] (9 species)
   not a true protein

7. Species Artificial gene [TaxId:32630] [188991] (9 PDB entries)

8. Domain d3o6yx1: 3o6y X:2-245 [182847]
   Other proteins in same PDB: d3o6yx2
   automated match to d1a53a_
   complexed with so4

Details for d3o6yx1

PDB Entry: 3o6y, 2.09 Å

PDB Description: robust computational design, optimization, and structural characterization of retroaldol enzymes

PDB Compounds: (X:) Retro-Aldolase

SCOPe Domain Sequences for d3o6yx1:

Sequence; same for both SEQRES and ATOM records:

>d3o6yx1 c.1.2.4 (X:2-245) automated matches {Artificial gene [TaxId: 32630]}
prylkgwledvvqlslrrpsvrasrqrpiislnerilefnkrnitaiiatymrkspwgld
verdpieyakfmeryavglsicteekyangsyetlrkiassvsipilmadfivkesqidd
aynlgadtvplivkiltereleslleyarsygmepiikindendldialrigarfigics
rdwetleinkenqrklismipsnvvkvastgiserneieelrklgvnafsiisslmrnpe
kike

Timeline for d3o6yx1:

• d3o6yx1 first appeared in SCOPe 2.01, called d3o6yx_
  
• d3o6yx1 was called d3o6yx_ in SCOPe 2.05
  
• d3o6yx1 appears in SCOPe 2.07
  
• d3o6yx1 appears in the current release, SCOPe 2.08