SCOPe 2.03: Domain d3o6tb_: 3o6t B:

Lineage for d3o6tb_ (3o6t B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (107 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [189521] (1 PDB entry)

8. Domain d3o6tb_: 3o6t B: [182842]
   automated match to d1nw2a_
   complexed with pge, px5; mutant

Details for d3o6tb_

PDB Entry: 3o6t, 2.4 Å

PDB Description: Mycobacterium tuberculosis thioredoxin C C40S mutant in Complex with Quinol Inhibitor PMX464

PDB Compounds: (B:) thioredoxin

SCOPe Domain Sequences for d3o6tb_:

Sequence; same for both SEQRES and ATOM records:

>d3o6tb_ c.47.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
satikvtdasfatdvlssnkpvlvdfwatwcgpskmvapvleeiateratdltvakldvd
tnpetarnfqvvsiptlilfkdgqpvkrivgakgkaallrelsdvvpnln

Timeline for d3o6tb_:

• d3o6tb_ first appeared in SCOPe 2.01
  
• d3o6tb_ appears in SCOPe 2.02
  
• d3o6tb_ appears in SCOPe 2.04
  
• d3o6tb_ appears in the current release, SCOPe 2.08