Lineage for d1bmfd1 (1bmf D:358-475)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 282945Fold a.69: Left-handed superhelix [47916] (3 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 282946Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 282947Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 282987Protein F1 ATP synthase beta subunit, domain 3 [88928] (4 species)
  7. 282990Species Cow (Bos taurus) [TaxId:9913] [88929] (10 PDB entries)
  8. 283000Domain d1bmfd1: 1bmf D:358-475 [18284]
    Other proteins in same PDB: d1bmfa1, d1bmfa2, d1bmfa3, d1bmfb1, d1bmfb2, d1bmfb3, d1bmfc1, d1bmfc2, d1bmfc3, d1bmfd2, d1bmfd3, d1bmfe2, d1bmfe3, d1bmff2, d1bmff3, d1bmfg_

Details for d1bmfd1

PDB Entry: 1bmf (more details), 2.85 Å

PDB Description: bovine mitochondrial f1-atpase

SCOP Domain Sequences for d1bmfd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bmfd1 a.69.1.1 (D:358-475) F1 ATP synthase beta subunit, domain 3 {Cow (Bos taurus)}
mdpnivgsehydvargvqkilqdykslqdiiailgmdelseedkltvsrarkiqrflsqp
fqvaevftghlgklvplketikgfqqilageydhlpeqafymvgpieeavakadklae

SCOP Domain Coordinates for d1bmfd1:

Click to download the PDB-style file with coordinates for d1bmfd1.
(The format of our PDB-style files is described here.)

Timeline for d1bmfd1: