SCOPe 2.07: Domain d3o6ga1: 3o6g A:3-263

Lineage for d3o6ga1 (3o6g A:3-263)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)

6. Protein Glutamate receptor ligand binding core [53881] (5 species)

7. Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (157 PDB entries)

8. Domain d3o6ga1: 3o6g A:3-263 [182836]
   Other proteins in same PDB: d3o6ga2
   automated match to d1lbcb_
   complexed with edo, glu, o27, so4

Details for d3o6ga1

PDB Entry: 3o6g, 1.8 Å

PDB Description: ligand-binding domain of glua2 (flip) ionotropic glutamate receptor in complex with an allosteric modulator

PDB Compounds: (A:) Glutamate receptor 2

SCOPe Domain Sequences for d3o6ga1:

Sequence; same for both SEQRES and ATOM records:

>d3o6ga1 c.94.1.1 (A:3-263) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgtpvnlavlkls
eqgvldklknkwwydkgecga

Timeline for d3o6ga1:

• d3o6ga1 first appeared in SCOPe 2.01, called d3o6ga_
  
• d3o6ga1 appears in SCOPe 2.06
  
• d3o6ga1 appears in the current release, SCOPe 2.08