SCOPe 2.01: Domain d3o6da_: 3o6d A:

Lineage for d3o6da_ (3o6d A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.24: Pyridoxine 5'-phosphate synthase [63892] (2 families)

5. Family c.1.24.0: automated matches [191640] (1 protein)
   not a true family

6. Protein automated matches [191177] (1 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:192222] [189430] (2 PDB entries)

8. Domain d3o6da_: 3o6d A: [182835]
   automated match to d1ho1a_
   complexed with po4, pxp

Details for d3o6da_

PDB Entry: 3o6d, 1.95 Å

PDB Description: pyridoxal phosphate biosynthetic protein pdxj from campylobacter jejuni in complex with pyridoxine-5'-phosphate

PDB Compounds: (A:) pyridoxine 5'-phosphate synthase

SCOPe Domain Sequences for d3o6da_:

Sequence; same for both SEQRES and ATOM records:

>d3o6da_ c.1.24.0 (A:) automated matches {Campylobacter jejuni [TaxId: 192222]}
namllgvnidhiavlrqarmvndpdlleaafivarhgdqitlhvredrrhaqdfdlenii
kfckspvnlecalndeilnlalklkphrvtlvpekreelttegglclnhaklkqsieklq
nanievslfinpslediekskilkaqfielhtghyanlhnalfsnishtafalkeldqdk
ktlqaqfekelqnlelcakkglelglkvaaghglnyknvkpvvkikeicelnigqsivar
svftglqnailemkelikr

Timeline for d3o6da_:

• d3o6da_ is new in SCOPe 2.01-stable
  
• d3o6da_ appears in SCOPe 2.02
  
• d3o6da_ appears in the current release, SCOPe 2.08, called d3o6da1