Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (161 species) not a true protein |
Species Staphylococcus aureus [TaxId:158878] [189432] (1 PDB entry) |
Domain d3o66b_: 3o66 B: [182830] automated match to d1sw1a_ complexed with act, pge |
PDB Entry: 3o66 (more details), 1.86 Å
SCOPe Domain Sequences for d3o66b_:
Sequence, based on SEQRES records: (download)
>d3o66b_ c.94.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 158878]} dvkitalstsesqiishmlrlliehdthgkikptlvnnlgsstiqhnalingdanisgvr yngtdltgalkeapikdpkkamiatqqgfkkkfdqtffdsygfantyafmvtketakkyh letvsdlakhskdlrlgmdsswmnrkgdgyegfkkeygfdfgtvrpmqiglvydalntek ldvalgystdgriaaydlkvlkddkqffppyaasavatnellrqhpelkttinkltgkis tsemqrlnyeadgkgkepavvaeeflkkhhyfd
>d3o66b_ c.94.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 158878]} dvkitalstsesqiishmlrlliehdthgkikptlvnnlgsstiqhnalingdanisgvr yngtdltgalkeapikdpkkamiatqqgfkkkfdqtffdsygfantyafmvtketakkyh letvsdlakhskdlrlgmdsswmnrgdgyegfkkeygfdfgtvrpmqiglvydalntekl dvalgystdgriaaydlkvlkddkqffppyaasavatnellrqhpelkttinkltgkist semqrlnyeadgkgkepavvaeeflkkhhyfd
Timeline for d3o66b_: