| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) ![]() |
| Family d.113.1.1: MutT-like [55812] (17 proteins) |
| Protein ADP-ribose pyrophosphatase homologue YffH [103201] (1 species) |
| Species Escherichia coli [TaxId:562] [103202] (5 PDB entries) |
| Domain d3o61d_: 3o61 D: [182822] automated match to d1viua_ complexed with cl, gdd, mg, na |
PDB Entry: 3o61 (more details), 2.45 Å
SCOPe Domain Sequences for d3o61d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o61d_ d.113.1.1 (D:) ADP-ribose pyrophosphatase homologue YffH {Escherichia coli [TaxId: 562]}
tqqitlikdkilsdnyftlhnitydltrkdgevirhkrevydrgngatillyntkkktvv
lirqfrvatwvngnesgqliescaglldndepevcirkaaieetgyevgevrklfelyms
pggvtelihffiaeysdnqranagggvededievlelpfsqalemiktgeirdgktvlll
nylqtshlmd
Timeline for d3o61d_: