Lineage for d3o5zb_ (3o5z B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 946133Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 946224Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 946580Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 946581Protein automated matches [190457] (5 species)
    not a true protein
  7. 946601Species Human (Homo sapiens) [TaxId:9606] [187598] (8 PDB entries)
  8. 946612Domain d3o5zb_: 3o5z B: [182818]
    automated match to d1pnja_
    complexed with cl, mpd

Details for d3o5zb_

PDB Entry: 3o5z (more details), 2.01 Å

PDB Description: Crystal structure of the SH3 domain from p85beta subunit of phosphoinositide 3-kinase (PI3K)
PDB Compounds: (B:) Phosphatidylinositol 3-kinase regulatory subunit beta

SCOPe Domain Sequences for d3o5zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o5zb_ b.34.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
egfqyralypfrrerpedlellpgdvlvvsraalqalgvaeggercpqsvgwmpglnert
rqrgdfpgtyveflgpva

SCOPe Domain Coordinates for d3o5zb_:

Click to download the PDB-style file with coordinates for d3o5zb_.
(The format of our PDB-style files is described here.)

Timeline for d3o5zb_: