SCOPe 2.07: Domain d3o5ta_: 3o5t A:

Lineage for d3o5ta_ (3o5t A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.209: ADP-ribosylglycohydrolase [101477] (1 superfamily)
   multihelical; bundle

4. Superfamily a.209.1: ADP-ribosylglycohydrolase [101478] (2 families)

5. Family a.209.1.0: automated matches [191592] (1 protein)
   not a true family

6. Protein automated matches [191071] (2 species)
   not a true protein

7. Species Azospirillum brasilense [TaxId:192] [188978] (3 PDB entries)

8. Domain d3o5ta_: 3o5t A: [182815]
   Other proteins in same PDB: d3o5tb_
   automated match to d1t5ja_
   complexed with adp, mg

Details for d3o5ta_

PDB Entry: 3o5t, 2.09 Å

PDB Description: Structure of DraG-GlnZ complex with ADP

PDB Compounds: (A:) Dinitrogenase reductase activacting glicohydrolase

SCOPe Domain Sequences for d3o5ta_:

Sequence; same for both SEQRES and ATOM records:

>d3o5ta_ a.209.1.0 (A:) automated matches {Azospirillum brasilense [TaxId: 192]}
dhsirsralgaylglacgdalgatvefltkgeiahqygvhkhikgggwlklpagqvtddt
emsihlgrailaapewdarraaeefavwlkgvpvdvgdttrrgirrfimhgtlsepesey
hagngaamrnlpvalatlgddaaferwtveqahithcnamsdaatltlghmvrrlvlggd
vrdvrdesnkliakhrqfkfqpyrglatayivdtmqtvmhyyfqtdsvescvvetvnqgg
dadttgaiagmlagatygvetipprwlrkldrdvyneicaqvdgllarapalkqg

Timeline for d3o5ta_:

• d3o5ta_ first appeared in SCOPe 2.01
  
• d3o5ta_ appears in SCOPe 2.06
  
• d3o5ta_ appears in the current release, SCOPe 2.08