Lineage for d3o5ng_ (3o5n G:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2048292Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2048293Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2048294Family b.36.1.1: PDZ domain [50157] (47 protein domains)
    Pfam PF00595
  6. 2048590Protein automated matches [190055] (6 species)
    not a true protein
  7. 2048667Species Mouse (Mus musculus) [TaxId:10090] [189198] (6 PDB entries)
  8. 2048675Domain d3o5ng_: 3o5n G: [182813]
    automated match to d1q3ob_
    complexed with br0

Details for d3o5ng_

PDB Entry: 3o5n (more details), 1.83 Å

PDB Description: Tetrahydroquinoline carboxylates are potent inhibitors of the Shank PDZ domain, a putative target in autism disorders
PDB Compounds: (G:) SH3 and multiple ankyrin repeat domains protein 3

SCOPe Domain Sequences for d3o5ng_:

Sequence, based on SEQRES records: (download)

>d3o5ng_ b.36.1.1 (G:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dyviddkvailqkrdhegfgfvlrgakaetpieeftptpafpalqylesvdvegvawrag
lrtgdflievngvnvvkvghkqvvglirqggnrlvmkvvsvtrk

Sequence, based on observed residues (ATOM records): (download)

>d3o5ng_ b.36.1.1 (G:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dyviddkvailqkrdhegfgfvlreftptpafpalqylesvdvegvawraglrtgdflie
vngvnvvkvghkqvvglirqggnrlvmkvvsvtrk

SCOPe Domain Coordinates for d3o5ng_:

Click to download the PDB-style file with coordinates for d3o5ng_.
(The format of our PDB-style files is described here.)

Timeline for d3o5ng_: