SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3o5ng_ (3o5n G:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2048292Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2048293Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2048294Family b.36.1.1: PDZ domain [50157] (47 protein domains)
    Pfam PF00595
  6. 2048590Protein automated matches [190055] (7 species)
    not a true protein
  7. 2048667Species Mouse (Mus musculus) [TaxId:10090] [189198] (6 PDB entries)
  8. 2048675Domain d3o5ng_: 3o5n G: [182813]
    automated match to d1q3ob_
    complexed with br0

Details for d3o5ng_

PDB Entry: 3o5n (more details), 1.83 Å

PDB Description: Tetrahydroquinoline carboxylates are potent inhibitors of the Shank PDZ domain, a putative target in autism disorders
PDB Compounds: (G:) SH3 and multiple ankyrin repeat domains protein 3

SCOPe Domain Sequences for d3o5ng_:

Sequence, based on SEQRES records: (download)

>d3o5ng_ b.36.1.1 (G:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dyviddkvailqkrdhegfgfvlrgakaetpieeftptpafpalqylesvdvegvawrag
lrtgdflievngvnvvkvghkqvvglirqggnrlvmkvvsvtrk

Sequence, based on observed residues (ATOM records): (download)

>d3o5ng_ b.36.1.1 (G:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dyviddkvailqkrdhegfgfvlreftptpafpalqylesvdvegvawraglrtgdflie
vngvnvvkvghkqvvglirqggnrlvmkvvsvtrk

SCOPe Domain Coordinates for d3o5ng_:

Click to download the PDB-style file with coordinates for d3o5ng_.
(The format of our PDB-style files is described here.)

Timeline for d3o5ng_: