Lineage for d3o55a_ (3o55 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311272Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2312098Superfamily a.24.15: FAD-dependent thiol oxidase [69000] (2 families) (S)
  5. 2312099Family a.24.15.1: FAD-dependent thiol oxidase [69001] (3 proteins)
  6. 2312100Protein Augmenter of liver regeneration [89018] (2 species)
    a mammalian FAD-dependent sulfhydryl oxidase
  7. 2312101Species Human (Homo sapiens) [TaxId:9606] [189907] (7 PDB entries)
  8. 2312108Domain d3o55a_: 3o55 A: [182806]
    automated match to d1oqca_
    complexed with fad

Details for d3o55a_

PDB Entry: 3o55 (more details), 1.9 Å

PDB Description: crystal structure of human fad-linked augmenter of liver regeneration (alr)
PDB Compounds: (A:) Augmenter of liver regeneration

SCOPe Domain Sequences for d3o55a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o55a_ a.24.15.1 (A:) Augmenter of liver regeneration {Human (Homo sapiens) [TaxId: 9606]}
fredcppdreelgrhswavlhtlaayypdlptpeqqqdmaqfihlfskfypceecaedlr
krlarnhpdtrtraaftqwlchlhnevnrklgkpdfdcskvderwrdgwkdgscd

SCOPe Domain Coordinates for d3o55a_:

Click to download the PDB-style file with coordinates for d3o55a_.
(The format of our PDB-style files is described here.)

Timeline for d3o55a_: