Lineage for d3o4vb_ (3o4v B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 996821Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 996837Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 996838Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 997377Protein automated matches [190142] (12 species)
    not a true protein
  7. 997382Species Escherichia coli [TaxId:562] [186867] (2 PDB entries)
  8. 997384Domain d3o4vb_: 3o4v B: [182798]
    automated match to d1nc1a_
    complexed with 4ct, gol, ipa

Details for d3o4vb_

PDB Entry: 3o4v (more details), 1.75 Å

PDB Description: Crystal structure of E. coli MTA/SAH nucleosidase in complex with (4-Chlorophenyl)thio-DADMe-ImmA
PDB Compounds: (B:) MTA/SAH nucleosidase

SCOPe Domain Sequences for d3o4vb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o4vb_ c.56.2.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
mkigiigameeevtllrdkienrqtislggceiytgqlngtevallksgigkvaaalgat
lllehckpdviintgsagglaptlkvgdivvsdearyhdadvtafgyeygqlpgcpagfk
addkliaaaeaciaelnlnavrglivsgdafingsvglakirhnfpqaiavemeataiah
vchnfnvpfvvvraisdvadqqshlsfdeflavaakqsslmveslvqklahg

SCOPe Domain Coordinates for d3o4vb_:

Click to download the PDB-style file with coordinates for d3o4vb_.
(The format of our PDB-style files is described here.)

Timeline for d3o4vb_: