SCOPe 2.04: Domain d3o4sa_: 3o4s A:

Lineage for d3o4sa_ (3o4s A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.0: automated matches [191381] (1 protein)
   not a true family

6. Protein automated matches [190475] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187400] (86 PDB entries)

8. Domain d3o4sa_: 3o4s A: [182794]
   automated match to d1jlna_
   complexed with gol, so4

Details for d3o4sa_

PDB Entry: 3o4s, 1.9 Å

PDB Description: Crystal Structure of HePTP with a Closed WPD Loop and an Ordered E-Loop

PDB Compounds: (A:) Tyrosine-protein phosphatase non-receptor type 7

SCOPe Domain Sequences for d3o4sa_:

Sequence; same for both SEQRES and ATOM records:

>d3o4sa_ c.45.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ntprevtlhflrtaghpltrwalqrqppdpkqleeeflkipsnfvspedldipghaskdr
yktilpnpqsrvclgraqsqedgdyinanyirgydgkekvyiatqgpmpntvsdfwemvw
qeevslivmltqlregkekcvhywpteeetygpfqiriqdmkecpeytvrqltiqyqeer
rsvkhilfsawpdhqtpesagpllrlvaeveespetaahpgpivvhcsagigrtgcfiat
rigcqqlkargevdilgivcqlrldrggmiqtaeqyqflhhtlalyagqlpee

Timeline for d3o4sa_:

• d3o4sa_ first appeared in SCOPe 2.01
  
• d3o4sa_ appears in SCOPe 2.03
  
• d3o4sa_ appears in SCOPe 2.05
  
• d3o4sa_ appears in the current release, SCOPe 2.08