SCOPe 2.07: Domain d3o4nb_: 3o4n B:

Lineage for d3o4nb_ (3o4n B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)

6. Protein Retroviral integrase, catalytic domain [53108] (4 species)

7. Species Rous sarcoma virus RSV [TaxId:11886] [53109] (23 PDB entries)

8. Domain d3o4nb_: 3o4n B: [182792]
   automated match to d1asua_
   complexed with mes, zn

Details for d3o4nb_

PDB Entry: 3o4n, 1.8 Å

PDB Description: Crystal structure of the Rous Associated Virus Integrase catalytic domain in MES buffer pH 6.0

PDB Compounds: (B:) integrase

SCOPe Domain Sequences for d3o4nb_:

Sequence, based on SEQRES records:

>d3o4nb_ c.55.3.2 (B:) Retroviral integrase, catalytic domain {Rous sarcoma virus RSV [TaxId: 11886]}
lqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwataiavlgrpka
iktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdkirvlaegdgfm
kripaskqgellakamyalnhf

Sequence, based on observed residues (ATOM records):

>d3o4nb_ c.55.3.2 (B:) Retroviral integrase, catalytic domain {Rous sarcoma virus RSV [TaxId: 11886]}
lqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwataiavlgrpka
iktdngscftskstrewlarwgiahttsqgqamveranrllkdkirvlaegdgfmkripa
skqgellakamyalnhf

Timeline for d3o4nb_:

• d3o4nb_ first appeared in SCOPe 2.01
  
• d3o4nb_ appears in SCOPe 2.06
  
• d3o4nb_ appears in the current release, SCOPe 2.08