Lineage for d3o4nb_ (3o4n B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2123751Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2124026Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 protein domains)
  6. 2124027Protein Retroviral integrase, catalytic domain [53108] (4 species)
  7. 2124114Species Rous sarcoma virus RSV [TaxId:11886] [53109] (23 PDB entries)
  8. 2124124Domain d3o4nb_: 3o4n B: [182792]
    automated match to d1asua_
    complexed with mes, zn

Details for d3o4nb_

PDB Entry: 3o4n (more details), 1.8 Å

PDB Description: Crystal structure of the Rous Associated Virus Integrase catalytic domain in MES buffer pH 6.0
PDB Compounds: (B:) integrase

SCOPe Domain Sequences for d3o4nb_:

Sequence, based on SEQRES records: (download)

>d3o4nb_ c.55.3.2 (B:) Retroviral integrase, catalytic domain {Rous sarcoma virus RSV [TaxId: 11886]}
lqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwataiavlgrpka
iktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdkirvlaegdgfm
kripaskqgellakamyalnhf

Sequence, based on observed residues (ATOM records): (download)

>d3o4nb_ c.55.3.2 (B:) Retroviral integrase, catalytic domain {Rous sarcoma virus RSV [TaxId: 11886]}
lqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvaaqhhwataiavlgrpka
iktdngscftskstrewlarwgiahttsqgqamveranrllkdkirvlaegdgfmkripa
skqgellakamyalnhf

SCOPe Domain Coordinates for d3o4nb_:

Click to download the PDB-style file with coordinates for d3o4nb_.
(The format of our PDB-style files is described here.)

Timeline for d3o4nb_: