Lineage for d3o4lb_ (3o4l B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1290588Protein beta2-microglobulin [88600] (5 species)
  7. 1290600Species Human (Homo sapiens) [TaxId:9606] [88602] (342 PDB entries)
    Uniprot P61769 21-119 ! Uniprot P01884
  8. 1290920Domain d3o4lb_: 3o4l B: [182789]
    Other proteins in same PDB: d3o4la1, d3o4la2, d3o4ld1, d3o4ld2, d3o4le1, d3o4le2
    automated match to d2f53b1
    complexed with gol, mes, so4

Details for d3o4lb_

PDB Entry: 3o4l (more details), 2.54 Å

PDB Description: Genetic and structural basis for selection of a ubiquitous T cell receptor deployed in Epstein-Barr virus
PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d3o4lb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o4lb_ b.1.1.2 (B:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]}
miqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
wsfyllyyteftptekdeyacrvnhvtlsqpcivkwdrdm

SCOPe Domain Coordinates for d3o4lb_:

Click to download the PDB-style file with coordinates for d3o4lb_.
(The format of our PDB-style files is described here.)

Timeline for d3o4lb_: