Lineage for d3o3rb_ (3o3r B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1817577Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 1817578Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 1817911Protein automated matches [190169] (5 species)
    not a true protein
  7. 1818025Species Norway rat (Rattus norvegicus) [TaxId:10116] [186935] (2 PDB entries)
  8. 1818029Domain d3o3rb_: 3o3r B: [182783]
    automated match to d1frba_
    complexed with nap

Details for d3o3rb_

PDB Entry: 3o3r (more details), 1.86 Å

PDB Description: Crystal Structure of AKR1B14 in complex with NADP
PDB Compounds: (B:) Aldo-keto reductase family 1, member B7

SCOPe Domain Sequences for d3o3rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o3rb_ c.1.7.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ttfvklrtkakmplvglgtwksppgqvkeavkaaidagyrhfdcayvyqnesevgeaiqe
kikekavrredlfivsklwstffekslmkeafqktlsdlkldyldlylihwpqglqagke
flpkdsqgkvlmskstfldawegmeelvdqglvkalgvsnfnhfqierllnkpglkhkpv
tnqvechpyltqekliqychskgiaviaysplgspdrpyakpedpvvleipkikeiaakh
kktiaqvlirfhvqrnvavipksvtlshikeniqvfdfqlseedmaailslnrnwracgl
fvtsdeedfpfheey

SCOPe Domain Coordinates for d3o3rb_:

Click to download the PDB-style file with coordinates for d3o3rb_.
(The format of our PDB-style files is described here.)

Timeline for d3o3rb_: