Lineage for d3o3ra_ (3o3r A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829136Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2829137Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 2829537Protein automated matches [190169] (7 species)
    not a true protein
  7. 2829652Species Norway rat (Rattus norvegicus) [TaxId:10116] [186935] (2 PDB entries)
  8. 2829655Domain d3o3ra_: 3o3r A: [182782]
    automated match to d1frba_
    complexed with nap

Details for d3o3ra_

PDB Entry: 3o3r (more details), 1.86 Å

PDB Description: Crystal Structure of AKR1B14 in complex with NADP
PDB Compounds: (A:) Aldo-keto reductase family 1, member B7

SCOPe Domain Sequences for d3o3ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o3ra_ c.1.7.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ttfvklrtkakmplvglgtwksppgqvkeavkaaidagyrhfdcayvyqnesevgeaiqe
kikekavrredlfivsklwstffekslmkeafqktlsdlkldyldlylihwpqglqagke
flpkdsqgkvlmskstfldawegmeelvdqglvkalgvsnfnhfqierllnkpglkhkpv
tnqvechpyltqekliqychskgiaviaysplgspdrpyakpedpvvleipkikeiaakh
kktiaqvlirfhvqrnvavipksvtlshikeniqvfdfqlseedmaailslnrnwracgl
fvtsdeedfpfheey

SCOPe Domain Coordinates for d3o3ra_:

Click to download the PDB-style file with coordinates for d3o3ra_.
(The format of our PDB-style files is described here.)

Timeline for d3o3ra_: