Lineage for d3o3qa_ (3o3q A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 951553Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 951554Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 951555Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)
  6. 951556Protein Acidic FGF (FGF1) [50357] (4 species)
  7. 951570Species Human (Homo sapiens) [TaxId:9606] [50359] (31 PDB entries)
    Uniprot P05230 16-152 ! Uniprot P05230
  8. 951573Domain d3o3qa_: 3o3q A: [182778]
    automated match to d1nzka_
    complexed with gol; mutant

Details for d3o3qa_

PDB Entry: 3o3q (more details), 1.6 Å

PDB Description: crystal structure of "l44f/m67i/l73v/a103g/deletion 104- 106/f108y/v109l/l111i/c117v/r119g/deletion 120-122" mutant form of human acidic fibroblast growth factor
PDB Compounds: (A:) heparin-binding growth factor 1

SCOPe Domain Sequences for d3o3qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o3qa_ b.42.1.1 (A:) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
kpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgevyikstetgqylaidt
dglvygsqtpneeclflerleenhyntyiskkhgwylgikkngsvkgthygqkailflpl
pvs

SCOPe Domain Coordinates for d3o3qa_:

Click to download the PDB-style file with coordinates for d3o3qa_.
(The format of our PDB-style files is described here.)

Timeline for d3o3qa_: