Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) consists of one domain of this fold |
Family c.55.3.1: Ribonuclease H [53099] (5 proteins) |
Protein automated matches [190266] (7 species) not a true protein |
Species Thermotoga maritima [TaxId:2336] [189559] (4 PDB entries) |
Domain d3o3ha_: 3o3h A: [182777] automated match to d2etja1 protein/DNA complex; protein/RNA complex; complexed with mn |
PDB Entry: 3o3h (more details), 2.8 Å
SCOPe Domain Sequences for d3o3ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o3ha_ c.55.3.1 (A:) automated matches {Thermotoga maritima [TaxId: 2336]} gidelykkefgivagvdeagrgclagpvvaaavvlekeiegindskqlspakrerlldei mekaavgigiaspeeidlynifnatklamnralenlsvkpsfvlvngkgielsvpgtclv kgdqkskligaasivakvfrdrlmsefhrmypqfsfhkhkgyatkehlneirkngvlpih rlsfepvlelltddllreffekglisenrferilnllgarks
Timeline for d3o3ha_: