Class a: All alpha proteins [46456] (289 folds) |
Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families) |
Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins) |
Protein F1 ATP synthase alpha subunit, domain 3 [88886] (5 species) |
Species Cow (Bos taurus) [TaxId:9913] [88893] (15 PDB entries) Uniprot P19483 |
Domain d1e1rc1: 1e1r C:380-510 [18277] Other proteins in same PDB: d1e1ra2, d1e1ra3, d1e1rb2, d1e1rb3, d1e1rc2, d1e1rc3, d1e1rd1, d1e1rd2, d1e1rd3, d1e1re1, d1e1re2, d1e1re3, d1e1rf1, d1e1rf2, d1e1rf3, d1e1rg_ complexed with adp, af3, anp, mg, po4 |
PDB Entry: 1e1r (more details), 2.5 Å
SCOPe Domain Sequences for d1e1rc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e1rc1 a.69.1.1 (C:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]} tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke ivtnflagfea
Timeline for d1e1rc1: