SCOPe 2.05: Domain d3o2ca_: 3o2c A:

Lineage for d3o2ca_ (3o2c A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore
   automatically mapped to Pfam PF00502

6. Protein Phycocyanin alpha subunit [88933] (9 species)

7. Species Synechococcus vulcanus [TaxId:32053] [88938] (8 PDB entries)

8. Domain d3o2ca_: 3o2c A: [182752]
   Other proteins in same PDB: d3o2cb_
   automated match to d1i7ya_
   complexed with cyc

Details for d3o2ca_

PDB Entry: 3o2c, 1.5 Å

PDB Description: Crystal structure of a rod form of c-phycocyanin from Themosynechococcus vulcanus at 1.5 angstroms

PDB Compounds: (A:) c-phycocyanin alpha subunit

SCOPe Domain Sequences for d3o2ca_:

Sequence; same for both SEQRES and ATOM records:

>d3o2ca_ a.1.1.3 (A:) Phycocyanin alpha subunit {Synechococcus vulcanus [TaxId: 32053]}
mktpiteaiaaadtqgrflsntelqavdgrfkravasmeaaraltnnaqslidgaaqavy
qkfpytttmqgsqyastpegkakcardigyylrmityclvaggtgpmdeyliaglseins
tfdlspswyiealkyikanhgltgqaaveanayidyainals

Timeline for d3o2ca_:

• d3o2ca_ first appeared in SCOPe 2.01
  
• d3o2ca_ appears in SCOPe 2.04
  
• d3o2ca_ appears in SCOPe 2.06
  
• d3o2ca_ appears in the current release, SCOPe 2.08