Lineage for d3o26a_ (3o26 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847941Species Papaver somniferum [TaxId:3469] [189571] (1 PDB entry)
  8. 2847942Domain d3o26a_: 3o26 A: [182746]
    automated match to d1wmaa1
    complexed with ndp

Details for d3o26a_

PDB Entry: 3o26 (more details), 1.91 Å

PDB Description: The structure of salutaridine reductase from Papaver somniferum.
PDB Compounds: (A:) Salutaridine reductase

SCOPe Domain Sequences for d3o26a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o26a_ c.2.1.0 (A:) automated matches {Papaver somniferum [TaxId: 3469]}
rrcavvtggnkgigfeickqlssngimvvltcrdvtkgheaveklknsnhenvvfhqldv
tdpiatmssladfikthfgkldilvnnagvagfsvdadrfkamisdigedseelvkiyek
peaqelmsetyelaeeclkinyngvksvtevlipllqlsdsprivnvssstgslkyvsne
taleilgdgdalteeridmvvnmllkdfkenlietngwpsfgaayttskaclnaytrvla
nkipkfqvncvcpglvktemnygignytaeegaehvvrialfpddgpsgffydc

SCOPe Domain Coordinates for d3o26a_:

Click to download the PDB-style file with coordinates for d3o26a_.
(The format of our PDB-style files is described here.)

Timeline for d3o26a_: