Lineage for d3o1va_ (3o1v A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2815433Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2815739Family b.82.2.10: AlkB-like [141628] (3 proteins)
    automatically mapped to Pfam PF13532
  6. 2815756Protein automated matches [191077] (2 species)
    not a true protein
  7. 2815757Species Escherichia coli K-12 [TaxId:83333] [189001] (20 PDB entries)
  8. 2815774Domain d3o1va_: 3o1v A: [182736]
    automated match to d2fd8a1
    complexed with fe, sin

Details for d3o1va_

PDB Entry: 3o1v (more details), 1.9 Å

PDB Description: Iron-Catalyzed Oxidation Intermediates Captured in A DNA Repair Dioxygenase
PDB Compounds: (A:) Alpha-ketoglutarate-dependent dioxygenase AlkB

SCOPe Domain Sequences for d3o1va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o1va_ b.82.2.10 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
plaagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwtthr
qgylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklclhqd
kdepdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqplk
agfhpltidcrynltfrqagkk

SCOPe Domain Coordinates for d3o1va_:

Click to download the PDB-style file with coordinates for d3o1va_.
(The format of our PDB-style files is described here.)

Timeline for d3o1va_: