Lineage for d3o1ua_ (3o1u A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 962884Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 963404Superfamily b.82.2: Clavaminate synthase-like [51197] (14 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 963621Family b.82.2.10: AlkB-like [141628] (3 proteins)
  6. 963637Protein automated matches [191077] (1 species)
    not a true protein
  7. 963638Species Escherichia coli K-12 [TaxId:83333] [189001] (14 PDB entries)
  8. 963644Domain d3o1ua_: 3o1u A: [182735]
    automated match to d2fd8a1
    complexed with fe, scc, sin

Details for d3o1ua_

PDB Entry: 3o1u (more details), 1.54 Å

PDB Description: Iron-Catalyzed Oxidation Intermediates Captured in A DNA Repair Dioxygenase
PDB Compounds: (A:) Alpha-ketoglutarate-dependent dioxygenase AlkB

SCOPe Domain Sequences for d3o1ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o1ua_ b.82.2.10 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
eplaagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwtth
rqgylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklclhq
dkdepdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqpl
kagfhpltidcrynltfrqagk

SCOPe Domain Coordinates for d3o1ua_:

Click to download the PDB-style file with coordinates for d3o1ua_.
(The format of our PDB-style files is described here.)

Timeline for d3o1ua_: