![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) ![]() Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
![]() | Family b.82.2.10: AlkB-like [141628] (3 proteins) automatically mapped to Pfam PF13532 |
![]() | Protein automated matches [191077] (2 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [189001] (20 PDB entries) |
![]() | Domain d3o1ua_: 3o1u A: [182735] automated match to d2fd8a1 complexed with fe, sin |
PDB Entry: 3o1u (more details), 1.54 Å
SCOPe Domain Sequences for d3o1ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o1ua_ b.82.2.10 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} eplaagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwtth rqgylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklclhq dkdepdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqpl kagfhpltidcrynltfrqagk
Timeline for d3o1ua_: