Lineage for d3o1ca_ (3o1c A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1891450Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 1891451Superfamily d.13.1: HIT-like [54197] (5 families) (S)
  5. 1891452Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins)
    Pfam PF01230
    topologically similar to the N-terminal domain of protein kinases
  6. 1891463Protein Histidine triad nucleotide-binding protein (HINT) [54199] (2 species)
  7. 1891471Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [54200] (9 PDB entries)
  8. 1891472Domain d3o1ca_: 3o1c A: [182726]
    automated match to d3rhna_
    complexed with adn, na; mutant

Details for d3o1ca_

PDB Entry: 3o1c (more details), 1.08 Å

PDB Description: high resolution crystal structure of histidine triad nucleotide- binding protein 1 (hint1) c38a mutant from rabbit complexed with adenosine
PDB Compounds: (A:) Histidine triad nucleotide-binding protein 1

SCOPe Domain Sequences for d3o1ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o1ca_ d.13.1.1 (A:) Histidine triad nucleotide-binding protein (HINT) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rpggdtifgkiirkeipakiifeddqalafhdispqapthflvipkkhisqisaaedade
sllghlmivgkkcaadlglkkgyrmvvnegsdggqsvyhvhlhvlggrqmnwppg

SCOPe Domain Coordinates for d3o1ca_:

Click to download the PDB-style file with coordinates for d3o1ca_.
(The format of our PDB-style files is described here.)

Timeline for d3o1ca_: