Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.13: HIT-like [54196] (2 superfamilies) alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha |
Superfamily d.13.1: HIT-like [54197] (5 families) |
Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins) Pfam PF01230 topologically similar to the N-terminal domain of protein kinases |
Protein Histidine triad nucleotide-binding protein (HINT) [54199] (1 species) |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [54200] (9 PDB entries) |
Domain d3o1ca_: 3o1c A: [182726] automated match to d3rhna_ complexed with adn, na; mutant |
PDB Entry: 3o1c (more details), 1.08 Å
SCOPe Domain Sequences for d3o1ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o1ca_ d.13.1.1 (A:) Histidine triad nucleotide-binding protein (HINT) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} rpggdtifgkiirkeipakiifeddqalafhdispqapthflvipkkhisqisaaedade sllghlmivgkkcaadlglkkgyrmvvnegsdggqsvyhvhlhvlggrqmnwppg
Timeline for d3o1ca_: