![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
![]() | Protein Phycocyanin beta subunit [88940] (8 species) |
![]() | Species Synechococcus vulcanus [TaxId:32053] [88944] (6 PDB entries) |
![]() | Domain d3o18b_: 3o18 B: [182725] Other proteins in same PDB: d3o18a_ automated match to d1i7yb_ complexed with cyc |
PDB Entry: 3o18 (more details), 1.35 Å
SCOPe Domain Sequences for d3o18b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o18b_ a.1.1.3 (B:) Phycocyanin beta subunit {Synechococcus vulcanus [TaxId: 32053]} mldafakvvaqadargefltnaqfdalsnlvkegnkrldavnritsnastivanaaralf aeqpqliqpggnaytnrrmaaclrdmeiilryvtyailagdssvlddrclnglretyqal gtpgssvavaiqkmkdaaiaiandpngitpgdcsalmseiagyfdraaaava
Timeline for d3o18b_: