Class a: All alpha proteins [46456] (286 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
Protein Phycocyanin alpha subunit [88933] (9 species) |
Species Synechococcus vulcanus [TaxId:32053] [88938] (8 PDB entries) |
Domain d3o18a_: 3o18 A: [182724] Other proteins in same PDB: d3o18b_ automated match to d1i7ya_ complexed with cyc |
PDB Entry: 3o18 (more details), 1.35 Å
SCOPe Domain Sequences for d3o18a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o18a_ a.1.1.3 (A:) Phycocyanin alpha subunit {Synechococcus vulcanus [TaxId: 32053]} mktpiteaiaaadtqgrflsntelqavdgrfkravasmeaaraltnnaqslidgaaqavy qkfpytttmqgsqyastpegkakcardigyylrmityclvaggtgpmdeyliaglseins tfdlspswyiealkyikanhgltgqaaveanayidyainals
Timeline for d3o18a_: