![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
![]() | Superfamily a.74.1: Cyclin-like [47954] (3 families) ![]() duplication: consists of two domains of this fold |
![]() | Family a.74.1.1: Cyclin [47955] (8 proteins) |
![]() | Protein CDK5 activator 1 (NCK5a, p25) [74739] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [74740] (5 PDB entries) Uniprot Q15078 145-294 |
![]() | Domain d3o0gd_: 3o0g D: [182722] Other proteins in same PDB: d3o0ga_, d3o0gb_ automated match to d1ungd_ complexed with 3o0 |
PDB Entry: 3o0g (more details), 1.95 Å
SCOPe Domain Sequences for d3o0gd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o0gd_ a.74.1.1 (D:) CDK5 activator 1 (NCK5a, p25) {Human (Homo sapiens) [TaxId: 9606]} qastsellrclgeflcrrcyrlkhlsptdpvlwlrsvdrslllqgwqdqgfitpanvvfl ymlcrdvissevgsdhelqavlltclylsysymgneisyplkpflvesckeafwdrclsv inlmsskmlqinadphyftqvfsdlknes
Timeline for d3o0gd_: