Lineage for d3o0gb_ (3o0g B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2587453Protein Cyclin-dependent PK, CDK5 [88857] (1 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 2587454Species Human (Homo sapiens) [TaxId:9606] [88858] (5 PDB entries)
    Uniprot Q00535
  8. 2587456Domain d3o0gb_: 3o0g B: [182721]
    Other proteins in same PDB: d3o0gd_, d3o0ge_
    automated match to d1unga_
    complexed with 3o0

Details for d3o0gb_

PDB Entry: 3o0g (more details), 1.95 Å

PDB Description: crystal structure of cdk5:p25 in complex with an atp analogue
PDB Compounds: (B:) cell division protein kinase 5

SCOPe Domain Sequences for d3o0gb_:

Sequence, based on SEQRES records: (download)

>d3o0gb_ d.144.1.7 (B:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]}
klekigegtygtvfkaknretheivalkrvrlddddegvpssalreicllkelkhknivr
lhdvlhsdkkltlvfefcdqdlkkyfdscngdldpeivksflfqllkglgfchsrnvlhr
dlkpqnllinrngelklanfglarafgipvrcysaevvtlwyrppdvlfgaklystsidm
wsagcifaelanagrplfpgndvddqlkrifrllgtpteeqwpsmtklpdykpypmypat
tslvnvvpklnatgrdllqnllkcnpvqrisaeealqhpyfsd

Sequence, based on observed residues (ATOM records): (download)

>d3o0gb_ d.144.1.7 (B:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]}
klekigtvfkaeivalkrvrpssalreicllkelkhknivrlhdvlhsdkkltlvfefcd
qdlkkyfdscngdldpeivksflfqllkglgfchsrnvlhrdlkpqnllinrngelklan
fglarafgipvrcysaevvtlwyrppdvlfgaklystsidmwsagcifaelanagrplfp
gndvddqlkrifrllgtpteeqwpsmtklpdykpypmypattslvnvvpklnatgrdllq
nllkcnpvqrisaeealqhpyfsd

SCOPe Domain Coordinates for d3o0gb_:

Click to download the PDB-style file with coordinates for d3o0gb_.
(The format of our PDB-style files is described here.)

Timeline for d3o0gb_: